PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_18137_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 194aa    MW: 22197.9 Da    PI: 8.6221
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_18137_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94.2e-192071556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     ++t++q++ Le+ F +n+++++e +++LA++lg+  rqV vW+qN+Ra++k
  Neem_18137_f_1 20 KRLTQDQVRLLERSFTSNKKLDTELKQKLANQLGVAPRQVAVWYQNKRARWK 71
                    569************************************************9 PP

2HD-ZIP_I/II105.15.5e-3419109393
     HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     k+rl+++qv+lLE+sF++++kL++e K++la++Lg+ prqvavW+qn+RAR+kt+ lE dy+a++ ++++  +e++rLek+v++Lreel++
  Neem_18137_f_1  19 KKRLTQDQVRLLERSFTSNKKLDTELKQKLANQLGVAPRQVAVWYQNKRARWKTQSLELDYNAIQVKLENALAEKRRLEKDVKQLREELRR 109
                     99*************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.7911373IPR001356Homeobox domain
SMARTSM003893.3E-151577IPR001356Homeobox domain
SuperFamilySSF466891.55E-161881IPR009057Homeodomain-like
CDDcd000862.46E-131974No hitNo description
PfamPF000462.1E-162071IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-182180IPR009057Homeodomain-like
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MDIFNSLQDQ KHPQKFHGKK RLTQDQVRLL ERSFTSNKKL DTELKQKLAN QLGVAPRQVA  60
VWYQNKRARW KTQSLELDYN AIQVKLENAL AEKRRLEKDV KQLREELRRA QQMLFALSNQ  120
KAVETNISTT VVSCNNYSTA TSCSDQKGHC SSFSSLLQED YVHGGDHDHH DDQALQIDHE  180
LYACLIGAGG SAWG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006464812.11e-89PREDICTED: homeobox-leucine zipper protein ATHB-52
RefseqXP_006451774.11e-89hypothetical protein CICLE_v10009522mg
TrEMBLV4WEM71e-89V4WEM7_9R
STRINGPOPTR_0011s11510.16e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121072632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.14e-35homeobox protein 52